Recombinant Full Length Human MYCT1 Protein, GST-tagged

• Cat.No.: MYCT1-6730HF
• Product Overview: Human MYCT1 full-length ORF (BAB15035.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 235 amino acids
• Description: MYCT1 (MYC Target 1) is a Protein Coding gene. Among its related pathways are Validated targets of C-MYC transcriptional activation.
• Molecular Mass: 53 kDa
• AA Sequence: MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTFQRRASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYCT1 myc target 1 [ Homo sapiens ]
• Official Symbol: MYCT1
• Synonyms: MYCT1; myc target 1; myc target protein 1; FLJ21269; MTLC; myc target in myeloid cells 1; myc target in myeloid cells protein 1; MGC156309; MGC156310
• Gene ID: 80177
• mRNA Refseq: NM_025107
• Protein Refseq: NP_079383
• MIM: 616805
• UniProt ID: Q8N699