Recombinant Human MYCBP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MYCBP-6398H
• Product Overview: MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene.
• Molecular Mass: 12 kDa
• AA Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MYCBP c-myc binding protein [ Homo sapiens (human) ]
• Official Symbol: MYCBP
• Synonyms: MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056
• Gene ID: 26292
• mRNA Refseq: NM_012333
• Protein Refseq: NP_036465
• MIM: 606535
• UniProt ID: Q99417