Recombinant Full Length Human MYCBP Protein, GST-tagged

• Cat.No.: MYCBP-6728HF
• Product Overview: Human MYCBP full-length ORF ( AAH08686, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 103 amino acids
• Description: The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM
• Molecular Mass: 37.07 kDa
• AA Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYCBP c-myc binding protein [ Homo sapiens ]
• Official Symbol: MYCBP
• Synonyms: MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056
• Gene ID: 26292
• mRNA Refseq: NM_012333
• Protein Refseq: NP_036465
• MIM: 606535
• UniProt ID: Q99417