Recombinant Human MUC7 protein, His-PDI-tagged
Cat.No. : | MUC7-4644H |
Product Overview : | Recombinant Human MUC7 protein(Q8TAX7)(23-377aa), fused with N-terminal His and PDI tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&PDI |
Protein Length : | 23-377aa |
Tag : | N-His-PDI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 95.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ |
Gene Name | MUC7 mucin 7, secreted [ Homo sapiens ] |
Official Symbol | MUC7 |
Synonyms | MUC7; mucin 7, secreted; mucin 7, salivary; mucin-7; FLJ27047; MG2; MUC-7; apo-MG2; salivary mucin-7; MGC34772; DKFZp686J03256; |
Gene ID | 4589 |
mRNA Refseq | NM_001145006 |
Protein Refseq | NP_001138478 |
MIM | 158375 |
UniProt ID | Q8TAX7 |
◆ Recombinant Proteins | ||
MUC7-1806H | Recombinant Human MUC7 Protein, His&GST-tagged | +Inquiry |
MUC7-3644H | Recombinant Human MUC7 protein, GST-tagged | +Inquiry |
MUC7-5751H | Recombinant Human MUC7 Protein, GST-tagged | +Inquiry |
MUC7-4644H | Recombinant Human MUC7 protein, His-PDI-tagged | +Inquiry |
MUC7-28540TH | Recombinant Human MUC7 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUC7 Products
Required fields are marked with *
My Review for All MUC7 Products
Required fields are marked with *
0
Inquiry Basket