Recombinant Human MUC7 protein, His-PDI-tagged

• Cat.No.: MUC7-4644H
• Product Overview: Recombinant Human MUC7 protein(Q8TAX7)(23-377aa), fused with N-terminal His and PDI tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His&PDI
• Protein Length: 23-377aa
• Tag: N-His-PDI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 95.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ

Gene Information

• Gene Name: MUC7 mucin 7, secreted [ Homo sapiens ]
• Official Symbol: MUC7
• Synonyms: MUC7; mucin 7, secreted; mucin 7, salivary; mucin-7; FLJ27047; MG2; MUC-7; apo-MG2; salivary mucin-7; MGC34772; DKFZp686J03256
• Gene ID: 4589
• mRNA Refseq: NM_001145006
• Protein Refseq: NP_001138478
• MIM: 158375
• UniProt ID: Q8TAX7