Recombinant Human MUC2 Protein, GST-tagged
Cat.No. : | MUC2-155H |
Product Overview : | Recombinant Human MUC2 Protein, fused to GST-tag, was expressed in E.coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 4958-5180 aa |
Description : | Mucins comprise a heterogeneous family of glycoproteins expressed by most specialized epithelial tissues of mucosal surfaces. MUC2 expression is detected in such human tissues as normal colon, breast, prostate, salivary gland, and in gastrointestinal, colonic, breast and prostate neoplasia. Of the known mucins, only MUC2, MUC5AC, and MUC5B are consistently associated with goblet cells. |
Form : | GST-MUC2 fusion protein was purified from E.coli and packaged at 500μg/ml in 50mM Tris-Acetate, pH7.5, 1mM EDTA, 20% Glycerol. |
Molecular Mass : | 50 kDa |
AA Sequence : | LLNVIACTHVPCNTSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRAR RSPRHLGSG |
Applications : | ELISA Inhibition Assays Western Blots |
Storage : | Store Vial at 4 centigrade for 1-2 weeks. For long term storage, store at -70 centigrade for up to twelve months from date of receipt. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.5 mg/ml |
Official Full Name : | Mucin 2, oligomeric mucus/gel-forming |
Gene Name | MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens (human) ] |
Official Symbol | MUC2 |
Synonyms | MLP; SMUC; MUC-2 |
Gene ID | 4583 |
mRNA Refseq | NM_002457 |
Protein Refseq | NP_002448 |
MIM | 158370 |
UniProt ID | A0A6Q8PFN2 |
◆ Recombinant Proteins | ||
MUC2-3254H | Recombinant Human MUC2 protein, His-tagged | +Inquiry |
Muc2-691M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
MUC2-1515H | Recombinant Human MUC2 Protein, GST tagged | +Inquiry |
Muc2-689M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
MUC2-155H | Recombinant Human MUC2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUC2 Products
Required fields are marked with *
My Review for All MUC2 Products
Required fields are marked with *
0
Inquiry Basket