Recombinant Human MUC2 protein, His-tagged

• Cat.No.: MUC2-3254H
• Product Overview: Recombinant Human MUC2 protein(Q02817)(36-240aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 36-240aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.8 kDa
• AA Sequence: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens ]
• Official Symbol: MUC2
• Synonyms: MUC2; mucin 2, oligomeric mucus/gel-forming; mucin 2, intestinal/tracheal; mucin-2; intestinal mucin-2; mucin-like protein; MLP; SMUC; MUC-2
• Gene ID: 4583
• mRNA Refseq: NM_002457
• Protein Refseq: NP_002448
• MIM: 158370
• UniProt ID: Q02817