Recombinant Human MTMR1 Protein, GST-tagged

• Cat.No.: MTMR1-5711H
• Product Overview: Human MTMR1 full-length ORF ( AAH11250, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 29.92 kDa
• AA Sequence: MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTMR1 myotubularin related protein 1 [ Homo sapiens ]
• Official Symbol: MTMR1
• Synonyms: MTMR1; myotubularin related protein 1; myotubularin-related protein 1
• Gene ID: 8776
• mRNA Refseq: NM_003828
• Protein Refseq: NP_003819
• MIM: 300171
• UniProt ID: Q13613