Recombinant Human MTMR1 Protein, GST-tagged

Cat.No. : MTMR1-5711H
Product Overview : Human MTMR1 full-length ORF ( AAH11250, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq
Molecular Mass : 29.92 kDa
AA Sequence : MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTMR1 myotubularin related protein 1 [ Homo sapiens ]
Official Symbol MTMR1
Synonyms MTMR1; myotubularin related protein 1; myotubularin-related protein 1;
Gene ID 8776
mRNA Refseq NM_003828
Protein Refseq NP_003819
MIM 300171
UniProt ID Q13613

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTMR1 Products

Required fields are marked with *

My Review for All MTMR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon