Recombinant Human MTHFS, His-tagged

Cat.No. : MTHFS-30253TH
Product Overview : Recombinant full length Human MTHFS with an N terminal His tag; 223 amino acids with tag, Predicted MWt 25.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 203 amino acids
Description : The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 25.400kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Sequence Similarities : Belongs to the 5-formyltetrahydrofolate cyclo-ligase family.
Gene Name MTHFS 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) [ Homo sapiens ]
Official Symbol MTHFS
Synonyms MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268;
Gene ID 10588
mRNA Refseq NM_001199758
Protein Refseq NP_001186687
MIM 604197
Uniprot ID P49914
Chromosome Location 15q24.3
Pathway Metabolic pathways, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem;
Function 5-formyltetrahydrofolate cyclo-ligase activity; 5-formyltetrahydrofolate cyclo-ligase activity; ATP binding; folic acid binding; ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTHFS Products

Required fields are marked with *

My Review for All MTHFS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon