Recombinant Human MTHFD2 protein, T7-tagged

Cat.No. : MTHFD2-136H
Product Overview : Recombinant human MTHFD2 (30 – 350aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 30-350 a.a.
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSII LVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGI APEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPG GDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFEAV KKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ]
Official Symbol MTHFD2
Synonyms MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase; NMDMC;
Gene ID 10797
mRNA Refseq NM_006636
Protein Refseq NP_006627
MIM 604887
UniProt ID P13995
Chromosome Location 2p13.1
Pathway C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem;
Function hydrolase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity; methylenetetrahydrofolate dehydrogenase (NAD+) activity; methylenetetrahydrofolate dehydrogenase (NADP+) activity; methylenetetrahydrofolate dehydrogenase (NADP+)

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTHFD2 Products

Required fields are marked with *

My Review for All MTHFD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon