Recombinant Bovine MTHFD2 Protein (36-350 aa), His-SUMO-tagged

• Cat.No.: MTHFD2-1868B
• Product Overview: Recombinant Bovine MTHFD2 Protein (36-350 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 36-350 aa
• Description: 5,10-methylenetetrahydrofolate + NAD+ = 5,10-methenyltetrahydrofolate + NADH. 5,10-methenyltetrahydrofolate + H2O = 10-formyltetrahydrofolate.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.9 kDa
• AA Sequence: EAVVISGRKLAEQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEELKKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Bos taurus (cattle) ]
• Official Symbol: MTHFD2
• Synonyms: MTHFD2; NAD-dependent methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate cyclohydrolase
• Gene ID: 517539
• mRNA Refseq: NM_001075755
• Protein Refseq: NP_001069223
• UniProt ID: Q0P5C2