Recombinant Human MTCP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MTCP1-3906H
• Product Overview: MTCP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018025) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.4 kDa
• AA Sequence: MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MTCP1 mature T-cell proliferation 1 [ Homo sapiens (human) ]
• Official Symbol: MTCP1
• Synonyms: MTCP1; mature T-cell proliferation 1; protein p13 MTCP-1; p8MTCP1; P13MTCP1; MTCP-1 type B1; mature T-cell proliferation-1 type B1; mature T-cell proliferation 1 isoform p13
• Gene ID: 4515
• mRNA Refseq: NM_001018025
• Protein Refseq: NP_001018025
• MIM: 300116
• UniProt ID: P56278