Recombinant Human MTCP1 Protein, GST-tagged

• Cat.No.: MTCP1-5688H
• Product Overview: Human MTCP1 full-length ORF ( AAH02600, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5 exon spliced to two different sets of 3 exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33 kDa
• AA Sequence: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTCP1 mature T-cell proliferation 1 [ Homo sapiens ]
• Official Symbol: MTCP1
• Synonyms: MTCP1; mature T-cell proliferation 1; protein p13 MTCP-1; p8MTCP1; P13MTCP1; MTCP-1 type B1; mature T-cell proliferation-1 type B1; mature T-cell proliferation 1 isoform p13
• Gene ID: 4515
• mRNA Refseq: NM_001018025
• Protein Refseq: NP_001018025
• MIM: 300116
• UniProt ID: P56278