Recombinant Full Length Human MTCP1 Protein, GST-tagged

Cat.No. : MTCP1-6485HF
Product Overview : Human MTCP1 full-length ORF ( AAH02600, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5 exon spliced to two different sets of 3 exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 33 kDa
Protein length : 68 amino acids
AA Sequence : MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTCP1 mature T-cell proliferation 1 [ Homo sapiens ]
Official Symbol MTCP1
Synonyms MTCP1; mature T-cell proliferation 1; protein p13 MTCP-1; p8MTCP1; P13MTCP1; MTCP-1 type B1; mature T-cell proliferation-1 type B1; mature T-cell proliferation 1 isoform p13;
Gene ID 4515
mRNA Refseq NM_001018025
Protein Refseq NP_001018025
MIM 300116
UniProt ID P56278

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTCP1 Products

Required fields are marked with *

My Review for All MTCP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon