Recombinant Human MTAP Protein, GST-tagged

Cat.No. : MTAP-5684H
Product Overview : Human MTAP full-length ORF ( AAH26106, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq
Molecular Mass : 56.87 kDa
AA Sequence : MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTAP methylthioadenosine phosphorylase [ Homo sapiens ]
Official Symbol MTAP
Synonyms MTAP; methylthioadenosine phosphorylase; S-methyl-5-thioadenosine phosphorylase; c86fus; MSAP; MTAPase; MTA phosphorylase; MeSAdo phosphorylase; 5-methylthioadenosine phosphorylase;
Gene ID 4507
mRNA Refseq NM_002451
Protein Refseq NP_002442
MIM 156540
UniProt ID Q13126

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MTAP Products

Required fields are marked with *

My Review for All MTAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon