Recombinant Human MT4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MT4-704H
Product Overview : MT4 MS Standard C13 and N15-labeled recombinant protein (NP_116324) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
Molecular Mass : 6.4 kDa
AA Sequence : MDPRECVCMSGGICMCGDNCKCTTCNCKTCRKSCCPCCPPGCAKCARGCICKGGSDKCSCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MT4 metallothionein 4 [ Homo sapiens (human) ]
Official Symbol MT4
Synonyms MT4; metallothionein 4; MT-4; MTIV; MT-IV; metallothionein-4; metallothionein-IV
Gene ID 84560
mRNA Refseq NM_032935
Protein Refseq NP_116324
MIM 606206

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MT4 Products

Required fields are marked with *

My Review for All MT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon