Recombinant Human MT4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MT4-704H
• Product Overview: MT4 MS Standard C13 and N15-labeled recombinant protein (NP_116324) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
• Molecular Mass: 6.4 kDa
• AA Sequence: MDPRECVCMSGGICMCGDNCKCTTCNCKTCRKSCCPCCPPGCAKCARGCICKGGSDKCSCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MT4 metallothionein 4 [ Homo sapiens (human) ]
• Official Symbol: MT4
• Synonyms: MT4; metallothionein 4; MT-4; MTIV; MT-IV; metallothionein-4; metallothionein-IV
• Gene ID: 84560
• mRNA Refseq: NM_032935
• Protein Refseq: NP_116324
• MIM: 606206