Recombinant Human MT4 Protein, His-SUMO-tagged
Cat.No. : | MT4-135H |
Product Overview : | Recombinant Human MT4 Protein (1-62aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-62 a.a. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP |
Purity : | Greater than 85% as determined by SDS-PAGE |
Storage : | Store at -20 centigrade/-80 centigrade. |
Gene Name | MT4 metallothionein 4 [ Homo sapiens (human) ] |
Official Symbol | MT4 |
Synonyms | MT-4; MTIV; MT-IV |
Gene ID | 84560 |
mRNA Refseq | NM_032935.2 |
Protein Refseq | NP_116324.1 |
MIM | 606206 |
UniProt ID | P47944 |
◆ Recombinant Proteins | ||
FBLN5-3133M | Recombinant Mouse FBLN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TFAP4-2133HFL | Recombinant Full Length Human TFAP4 Protein, C-Flag-tagged | +Inquiry |
POL-1040V | Recombinant Feline Immunodeficiency Virus Core Protein | +Inquiry |
HINT1-2500R | Recombinant Rat HINT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A10-4240R | Recombinant Rhesus monkey SLC25A10 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
IgE-18H | Native Human Immunoglobulin E, lambda | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Flaxseed-693P | Flaxseed Lysate, Total Protein | +Inquiry |
KLHL36-210HCL | Recombinant Human KLHL36 cell lysate | +Inquiry |
ZNF396-79HCL | Recombinant Human ZNF396 293 Cell Lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
HEBP2-5592HCL | Recombinant Human HEBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT4 Products
Required fields are marked with *
My Review for All MT4 Products
Required fields are marked with *
0
Inquiry Basket