Recombinant Human MT3

• Cat.No.: MT3-29501TH
• Product Overview: Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 68 amino acids
• Description: Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
• Molecular Weight: 33.480kDa inclusive of tags
• Tissue specificity: Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
• Sequence Similarities: Belongs to the metallothionein superfamily. Type 1 family.

Gene Information

• Gene Name: MT3 metallothionein 3 [ Homo sapiens ]
• Official Symbol: MT3
• Synonyms: MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF
• Gene ID: 4504
• mRNA Refseq: NM_005954
• Protein Refseq: NP_005945
• MIM: 139255
• Uniprot ID: P25713
• Chromosome Location: 16q13
• Function: antioxidant activity; copper ion binding; metal ion binding; zinc ion binding