Recombinant Human MT2A protein, GST-tagged

• Cat.No.: MT2A-3250H
• Product Overview: Recombinant Human MT2A protein(P02795)(1-59aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-59aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.9 kDa
• AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MT2A metallothionein 2A [ Homo sapiens ]
• Official Symbol: MT2A
• Synonyms: MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II
• Gene ID: 4502
• mRNA Refseq: NM_005953
• Protein Refseq: NP_005944
• MIM: 156360
• UniProt ID: P02795