Recombinant Human MT2A protein, GST-tagged
Cat.No. : | MT2A-3250H |
Product Overview : | Recombinant Human MT2A protein(P02795)(1-59aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-59aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.9 kDa |
AA Sequence : | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MT2A metallothionein 2A [ Homo sapiens ] |
Official Symbol | MT2A |
Synonyms | MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II; |
Gene ID | 4502 |
mRNA Refseq | NM_005953 |
Protein Refseq | NP_005944 |
MIM | 156360 |
UniProt ID | P02795 |
◆ Recombinant Proteins | ||
MT2A-2888R | Recombinant Rhesus monkey MT2A Protein, His-tagged | +Inquiry |
Mt2A-1898R | Recombinant Rat Mt2A protein, His & GST-tagged | +Inquiry |
MT2A-130H | Recombinant Human MT2A, GST-tagged | +Inquiry |
MT2A-1464H | Recombinant Human MT2A Protein (1-59 aa), His-tagged | +Inquiry |
MT2A-3250H | Recombinant Human MT2A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT2A Products
Required fields are marked with *
My Review for All MT2A Products
Required fields are marked with *
0
Inquiry Basket