Recombinant Human MT2A Protein (1-59 aa), His-tagged

• Cat.No.: MT2A-1464H
• Product Overview: Recombinant Human MT2A Protein (1-59 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 1-59 aa
• Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 7.9 kDa
• AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: MT2A metallothionein 2A [ Homo sapiens ]
• Official Symbol: MT2A
• Synonyms: MT2A; metallothionein 2A; MT2; MT-2; MT-II
• Gene ID: 4502
• mRNA Refseq: NM_005953
• Protein Refseq: NP_005944
• MIM: 156360
• UniProt ID: P02795