Recombinant Human MT1X Protein, His-tagged

Cat.No. : MT1X-130H
Product Overview : Recombinant Human MT1X Protein (1-59aa) was expressed in yeast with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-59 a.a.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 7.9kDa
AA Sequence : MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Purity : Greater than 90% as determined by SDS-PAGE
Storage : Store at -20 centigrade/-80 centigrade.
Gene Name MT1X metallothionein 1X [ Homo sapiens (human) ]
Official Symbol MT1X
Synonyms MT1; MT-1l
Gene ID 4501
mRNA Refseq NM_005952.3
Protein Refseq NP_005943.1
MIM 156359
UniProt ID P80297

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MT1X Products

Required fields are marked with *

My Review for All MT1X Products

Required fields are marked with *

0

Inquiry Basket

cartIcon