Recombinant Human MT1X protein, GST-tagged

• Cat.No.: MT1X-1302H
• Product Overview: Recombinant Human MT1X protein(NP_005943)(1-46 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-46 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSECRAFPANLGDGPI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: MT1X metallothionein 1X [ Homo sapiens (human) ]
• Official Symbol: MT1X
• Synonyms: MT1; MT-1l
• Gene ID: 4501
• mRNA Refseq: NM_005952.4
• Protein Refseq: NP_005943
• MIM: 156359
• UniProt ID: P80297