Recombinant Human MT-ND4

• Cat.No.: MT-ND4-27840TH
• Product Overview: Recombinant fragment of Human NADH dehydrogenase subunit 4 with N-terminal proprietary tag. Predicted MW 31.57kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 54 amino acids
• Molecular Weight: 31.570kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YSLYIFTTTQWGSLTHHINNIKPSFTRENTLMFIHLSPILLLSLNPDIITGFSS
• Sequence Similarities: Belongs to the complex I subunit 4 family.

Gene Information

• Gene Name: MT-ND4 mitochondrially encoded NADH dehydrogenase 4 [ Homo sapiens ]
• Official Symbol: MT-ND4
• Synonyms: MT-ND4; mitochondrially encoded NADH dehydrogenase 4; MTND4, NADH dehydrogenase 4; NADH dehydrogenase, subunit 4 (complex I); complex I ND4 subunit; NAD4; NADH ubiquinone oxidoreductase chain 4; ND4
• Gene ID: 4538
• Uniprot ID: P03905
• Chromosome Location: mitochondria
• Pathway: Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NAD/NADH phosphorylation and dephosphorylation, organism-specific biosystem; NADH:ubiquinone oxidoreductase, mitochondria, organism-specific biosystem
• Function: NADH dehydrogenase (ubiquinone) activity; oxidoreductase activity