Recombinant Human MSTN, His-tagged, Animal Free
Cat.No. : | MSTN-136H |
Product Overview : | Recombinant human Myostatin is a homodimer polypeptide chain containing 2X 109 amino acids (267 – 375 of O14793 Growth/differentiation factor 8) and 6 aa Histidine-based tag. It as a predicted molecular mass of 24.8 kDa (13.4 kDa under reducing conditions in SDSPAGE). Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human Myostatin contains a 6-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Protein Length : | 267-375 a.a. |
Description : | Myostatin (GDF8, MSTN) belongs to the transforming growth factor β (TGFBs) superfamily, which includes : TGF βs, the bone morphogenetic protein (BMPs), growth differentiation factors (GDFs), activins and inhibins. As other members of this superfamily , is synthesized and secreted as a homodimeric prepropeptide that is cleaved by proprotein convertases such as furin to generate the dimeric N- terminal propeptide and the dimeric C-terminal mature active protein.Myostatin is one of the most important protein that controls myoblast proliferation and it is a potent negative regulator of skeletal muscle mass in a number of animal species. Several studies have shown that Myostatin could play an important role in cardiac development and physiology.Genetic deletion of Myostatin or in vivo administration of the Myostatin propeptide induces muscle hypertrophy as well as enhanced glucose utilization and insulin sensitivity and a reduction in overall fat mass. |
Form : | Lyophilized from a Tris HCl 50mM, Urea 1.5 M, PMSF 0.04mM and Glycine 50mM Buffer pH 8. |
Molecular Mass : | Recombinant human Myostatin is a homodimer polypeptide chain containing 2X 109 amino acids (267 – 375 of O14793 Growth/differentiation factor 8) and 6 aa Histidine-based tag. It as a predicted molecular mass of 24.8 kDa (13.4 kDa under reducing conditi |
AA Sequence : | HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGS AGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
Endotoxin : | < 0.04="" eu="" ug="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Applications : | Western blot, Immunogen |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Lyophilized protein should be reconstituted in water to a concentration of 250 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions. |
Gene Name | MSTN myostatin [ Homo sapiens ] |
Official Symbol | MSTN |
Synonyms | MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP; |
Gene ID | 2660 |
mRNA Refseq | NM_005259 |
Protein Refseq | NP_005250 |
MIM | 601788 |
UniProt ID | O14793 |
Chromosome Location | 2q32.1 |
Pathway | Hypertrophy Model, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding; |
◆ Recombinant Proteins | ||
Mstn-6388R | Recombinant Rat Mstn Protein, His (Fc)-Avi-tagged | +Inquiry |
Mstn-91M | Recombinant Mouse Mstn Protein, His (Fc)-Avi-tagged | +Inquiry |
MSTN-3340H | Recombinant Human MSTN Protein (Lys262-Ser375) | +Inquiry |
MSTN-1851H | Recombinant Human MSTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSTN-15H | Recombinant Human MSTN protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *
0
Inquiry Basket