Recombinant Human MSH5 Protein, GST-tagged

• Cat.No.: MSH5-5652H
• Product Overview: Human MSH5 partial ORF ( AAH02498, 736 a.a. - 835 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. Alternative splicing results in four transcript variants encoding three different isoforms. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: GNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSH5 mutS homolog 5 (E. coli) [ Homo sapiens ]
• Official Symbol: MSH5
• Synonyms: MSH5; mutS homolog 5 (E. coli); mutS (E. coli) homolog 5; mutS protein homolog 5; G7; NG23; MUTSH5; MGC2939; DKFZp434C1615
• Gene ID: 4439
• mRNA Refseq: NM_002441
• Protein Refseq: NP_002432
• MIM: 603382
• UniProt ID: O43196