Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: MS4A15-161H
• Product Overview: MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: May be involved in signal transduction as a component of a multimeric receptor complex.
• Molecular Mass: 15.4 kDa
• AA Sequence: MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MS4A15 membrane spanning 4-domains A15 [ Homo sapiens (human) ]
• Official Symbol: MS4A15
• Synonyms: MS4A15; membrane spanning 4-domains A15; FLJ34527; MGC35295; membrane-spanning 4-domains subfamily A member 15
• Gene ID: 219995
• mRNA Refseq: NM_152717
• Protein Refseq: NP_689930
• UniProt ID: Q8N5U1