Recombinant Human MS4A1, GST-tagged

• Cat.No.: MS4A1-10H
• Product Overview: Recombinant Human MS4A1 encoding human MS4A1 full-length ORF (1 a.a. - 297 a.a.) produced in in vitro wheat germ expression system, was fused a GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
• Sequence: MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRES KTLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAA TEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRA HTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAGI VENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDI EIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
• Purification: Glutathione Sepharose 4 Fast Flow
• MolecularWeight: 58.41 kDa
• Applications: ELISA; WB
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ]
• Official Symbol: MS4A1
• Synonyms: MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16; B-lymphocyte antigen CD20; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; MGC3969; OTTHUMP00000236377; OTTHUMP00000236378
• Gene ID: 931
• mRNA Refseq: NM_021950
• Protein Refseq: NP_068769
• MIM: 118910
• UniProt ID: P11836
• Chromosome Location: 11q12
• Pathway: Hematopoietic cell lineage
• Function: epidermal growth factor receptor binding