Recombinant Human MRPS11, His-tagged

• Cat.No.: MRPS11-28172TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-194 of Human MRPS11 with N terminal His tag, 26kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-194 a.a.
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 164 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQL QDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGK KFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFR NAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGP GRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
• Sequence Similarities: Belongs to the ribosomal protein S11P family.
• Full Length: Full L.

Gene Information

• Gene Name: MRPS11 mitochondrial ribosomal protein S11 [ Homo sapiens ]
• Official Symbol: MRPS11
• Synonyms: MRPS11; mitochondrial ribosomal protein S11; 28S ribosomal protein S11, mitochondrial; cervical cancer proto oncogene 2; FLJ22512; FLJ23406; HCC 2
• Gene ID: 64963
• mRNA Refseq: NM_176805
• Protein Refseq: NP_789775
• MIM: 611977
• Uniprot ID: P82912
• Chromosome Location: 15q25
• Function: structural constituent of ribosome