Recombinant Human MRPL40, His-tagged

• Cat.No.: MRPL40-146H
• Product Overview: Recombinant Human 39S Ribosomal Protein L40 Mitochondrial/MRPL40 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser47-Arg206) of Human MRPL40 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 47-206 a.a.
• AA Sequence: SEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEET ERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGP HYTPPIPNYQPPEGRYNDITKVYTQVEFKRVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: MRPL40 mitochondrial ribosomal protein L40 [ Homo sapiens ]
• Official Symbol: MRPL40
• Synonyms: MRPL40; mitochondrial ribosomal protein L40; NLVCF, nuclear localization signal deleted in velocardiofacial syndrome; 39S ribosomal protein L40, mitochondrial; MRP L22; L40mt; MRP-L40; up-regulated in metastasis; nuclear localization signal deleted in velocardiofacial syndrome; nuclear localization signal containing protein deleted in velocardiofacial syndrome; nuclear localization signal-containing protein deleted in velocardiofacial syndrome; URIM; NLVCF; MRP-L22; MGC9400; FLJ41774
• Gene ID: 64976
• mRNA Refseq: NM_003776
• Protein Refseq: NP_003767
• MIM: 605089
• UniProt ID: Q9NQ50
• Chromosome Location: 22q11.2
• Function: molecular_function