Recombinant Human MRO Protein, GST-tagged
Cat.No. : | MRO-5551H |
Product Overview : | Human MRO full-length ORF ( NP_114145.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 55.4 kDa |
AA Sequence : | MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDPSAKKRHMAMRNLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGKIQGKGLGSFFIDIALQTRTLLDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRO maestro [ Homo sapiens (human) ] |
Official Symbol | MRO |
Synonyms | MRO; maestro; B29; C18orf3; protein maestro; beside the Ma29 deletion; male-specific transcription in the developing reproductive organs |
Gene ID | 83876 |
mRNA Refseq | NM_001127174 |
Protein Refseq | NP_001120646 |
MIM | 608080 |
UniProt ID | Q9BYG7 |
◆ Recombinant Proteins | ||
MRO-6372HF | Recombinant Full Length Human MRO Protein, GST-tagged | +Inquiry |
MRO-5551H | Recombinant Human MRO Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRO-4200HCL | Recombinant Human MRO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRO Products
Required fields are marked with *
My Review for All MRO Products
Required fields are marked with *
0
Inquiry Basket