Recombinant Full Length Human MRO Protein, GST-tagged

• Cat.No.: MRO-6372HF
• Product Overview: Human MRO full-length ORF ( NP_114145.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 248 amino acids
• Description: This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 55.4 kDa
• AA Sequence: MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDPSAKKRHMAMRNLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGKIQGKGLGSFFIDIALQTRTLLDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRO maestro [ Homo sapiens (human) ]
• Official Symbol: MRO
• Synonyms: MRO; maestro; B29; C18orf3; protein maestro; beside the Ma29 deletion; male-specific transcription in the developing reproductive organs
• Gene ID: 83876
• mRNA Refseq: NM_001127174
• Protein Refseq: NP_001120646
• MIM: 608080
• UniProt ID: Q9BYG7