Recombinant Human MPZ protein, His-tagged

• Cat.No.: MPZ-8493H
• Product Overview: Recombinant Human MPZ(Ile30-Arg153) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Ile30-Arg153
• Description: Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease.
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
• AA Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGT FKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHH HH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: MPZ myelin protein zero [ Homo sapiens ]
• Official Symbol: MPZ
• Synonyms: MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; myelin peripheral protein; Charcot-Marie-Tooth neuropathy 1B; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3
• Gene ID: 4359
• mRNA Refseq: NM_000530
• Protein Refseq: NP_000521
• MIM: 159440
• UniProt ID: P25189
• Chromosome Location: 1q22
• Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem
• Function: structural molecule activity