Recombinant Human MPLKIP Protein, GST-tagged

• Cat.No.: MPLKIP-5218H
• Product Overview: Human C7orf11 full-length ORF ( NP_619646.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is thought to function in regulating mitosis and cytokinesis. Mutations in this gene result in nonphotosensitive trichothiodystrophy. [provided by RefSeq, Nov 2009]
• Molecular Mass: 45.5 kDa
• AA Sequence: MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPLKIP M-phase specific PLK1 interacting protein [ Homo sapiens (human) ]
• Official Symbol: MPLKIP
• Synonyms: C7orf11; MPLKIP; M-phase specific PLK1 interacting protein; M-phase-specific PLK1-interacting protein; Russell-Silver syndrome region; TTD non-photosensitive 1 protein
• Gene ID: 136647
• mRNA Refseq: NM_138701
• Protein Refseq: NP_619646
• MIM: 609188
• UniProt ID: Q8TAP9