Recombinant Human MPHOSPH6 protein, T7-tagged

• Cat.No.: MPHOSPH6-138H
• Product Overview: Recombinant human MPHOSPH6 (160aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 160 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIE EQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDH ANYEEDENGDITPIKAKKMFLKPQD
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ]
• Official Symbol: MPHOSPH6
• Synonyms: MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6
• Gene ID: 10200
• mRNA Refseq: NM_005792
• Protein Refseq: NP_005783
• MIM: 605500
• UniProt ID: Q99547
• Chromosome Location: 16q23.3
• Pathway: RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem
• Function: RNA binding; protein binding