Recombinant Full Length Human MPHOSPH6 Protein, GST-tagged

• Cat.No.: MPHOSPH6-6321HF
• Product Overview: Human MPHOSPH6 full-length ORF ( AAH05242, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 160 amino acids
• Description: MPHOSPH6 (M-Phase Phosphoprotein 6) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and rRNA processing in the nucleus and cytosol. GO annotations related to this gene include RNA binding.
• Molecular Mass: 43.34 kDa
• AA Sequence: MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPHOSPH6 M-phase phosphoprotein 6 [ Homo sapiens ]
• Official Symbol: MPHOSPH6
• Synonyms: MPHOSPH6; M-phase phosphoprotein 6; MPP6; MPP; MPP-6
• Gene ID: 10200
• mRNA Refseq: NM_005792
• Protein Refseq: NP_005783
• MIM: 605500
• UniProt ID: Q99547