Recombinant Human/Mouse NTF3 Protein

Cat.No. : NTF3-218H
Product Overview : Recombinant Human/Mouse NTF3 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human/Mouse
Source : E.coli
Description : Neurotrophin-3 (NT-3) is an important member of the nerve growth factor (NGF) family of proteins. NT-3 promotes the growth, survival, and differentiation of neurons and synapses in the peripheral and central nervous systems. The receptor tyrosine kinase TrkC exclusively binds in high-affinity to NT-3. NT-3 also signals through the receptor tyrosine kinase TrkB, and through the low affinity nerve growth factor receptor (LNGFR).
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer (Noncovalently linked), 13.8/27.5 kDa (120/240 aa)
AA Sequence : MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name NTF3 neurotrophin 3 [ Homo sapiens (human) ]
Official Symbol NTF3
Synonyms NTF3; neurotrophin 3; neurotrophin-3; NGF2; NT-3; neurotrophic factor; nerve growth factor 2; NT3; HDNF; NGF-2; MGC129711;
Gene ID 4908
mRNA Refseq NM_001102654
Protein Refseq NP_001096124
MIM 162660
UniProt ID P20783

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NTF3 Products

Required fields are marked with *

My Review for All NTF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon