Recombinant Human MOCS2 protein, GST-tagged

• Cat.No.: MOCS2-3238H
• Product Overview: Recombinant Human MOCS2 protein(O96007)(1-188aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-188aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.9 kDa
• AA Sequence: MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MOCS2 molybdenum cofactor synthesis 2 [ Homo sapiens ]
• Official Symbol: MOCS2
• Synonyms: MOCS2; molybdenum cofactor synthesis 2; molybdopterin synthase catalytic subunit; MOCO1; MOCO1-A; MOCO1-B; MPT synthase large subunit; sulfur carrier protein MOCS2A; molybdopterin-synthase large subunit; molybdopterin-synthase small subunit; molybdenum cofactor synthesis protein 2A; molybdenum cofactor synthesis protein 2B; molybdenum cofactor biosynthesis protein E; molybdopterin synthase sulfur carrier subunit; molybdenum cofactor synthesis protein 2 large subunit; molybdenum cofactor synthesis protein 2 small subunit; MPTS; MCBPE; MOCS2A; MOCS2B
• Gene ID: 4338
• mRNA Refseq: NM_004531
• Protein Refseq: NP_004522
• MIM: 603708
• UniProt ID: O96007