Recombinant Human MN1 Protein, GST-tagged

• Cat.No.: MN1-5442H
• Product Overview: Human MN1 partial ORF ( NP_002421, 1212 a.a. - 1320 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis. [provided by RefSeq
• Molecular Mass: 37.73 kDa
• AA Sequence: STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ]
• Official Symbol: MN1
• Synonyms: MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN; meningioma chromosome region 1; meningioma (translocation balanced); MGCR; MGCR1-PEN; dJ353E16.2
• Gene ID: 4330
• mRNA Refseq: NM_002430
• Protein Refseq: NP_002421
• MIM: 156100
• UniProt ID: Q10571