Recombinant Human MN1

• Cat.No.: MN1-28419TH
• Product Overview: Recombinant fragment of Human MN1 with an N terminal proprietary tag; Predicted MWt 37.62 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 109 amino acids
• Description: Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis.
• Molecular Weight: 37.620kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed. Highest levels in skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKA KPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGD AKARASVPTWRSLHSDISNRFGTFVAALT

Gene Information

• Gene Name: MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ]
• Official Symbol: MN1
• Synonyms: MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN
• Gene ID: 4330
• mRNA Refseq: NM_002430
• Protein Refseq: NP_002421
• MIM: 156100
• Uniprot ID: Q10571
• Chromosome Location: 22q12.1
• Function: binding; molecular_function