Recombinant Human MMS19 Protein, GST-tagged

• Cat.No.: MMS19-5441H
• Product Overview: Human MMS19L full-length ORF ( AAH07298, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MMS19 (MMS19 Homolog, Cytosolic Iron-Sulfur Assembly Component) is a Protein Coding gene. Among its related pathways are Cytosolic iron-sulfur cluster assembly and Metabolism. GO annotations related to this gene include binding and protein binding, bridging.
• Molecular Mass: 57.97 kDa
• AA Sequence: MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MMS19 MMS19 nucleotide excision repair homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MMS19
• Synonyms: MMS19; MMS19 nucleotide excision repair homolog (S. cerevisiae); MMS19L; MMS19 nucleotide excision repair protein homolog; hMMS19; MET18; MET18 homolog (S. cerevisiae); MET18 homolog; MMS19-like protein; homolog of yeast MMS19; MMS19-like (MET18 homolog, S. cerevisiae); FLJ34167; FLJ95146; MGC99604
• Gene ID: 64210
• mRNA Refseq: NM_022362
• Protein Refseq: NP_071757
• UniProt ID: Q96T76