Recombinant Human MMP14 protein, His-tagged

• Cat.No.: MMP14-3649H
• Product Overview: Recombinant Human MMP14 protein(356-475 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His
• ProteinLength: 356-475 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: MMP14 matrix metallopeptidase 14 (membrane-inserted) [ Homo sapiens ]
• Official Symbol: MMP14
• Synonyms: MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1
• Gene ID: 4323
• mRNA Refseq: NM_004995
• Protein Refseq: NP_004986
• MIM: 600754
• UniProt ID: P50281