Recombinant Human MME, StrepII-tagged

• Cat.No.: MME-236H
• Product Overview: Purified human recombinant NeprilysinCD10 or Neprilysin protein (amino acids 55-750, 696 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 79.4 kDa. (Accession NP_000893.2; UniProt P08473)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 55-750, 696 a.a.
• Description: This product is the extracellular domain of CD10. CD10 is a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: GICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTED IVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLF VGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMEL EKEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTK LKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNMENAVGRLYVE AAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKE DEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIG MVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGG LGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEF SEAFHCRKNSYMNPEKKCRVW
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: ~90% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: MME membrane metallo-endopeptidase [ Homo sapiens ]
• Official Symbol: MME
• Synonyms: MME; membrane metallo-endopeptidase; neprilysin; CALLA; CD10; enkephalinase; NEP; neutral endopeptidase; atriopeptidase; skin fibroblast elastase; neutral endopeptidase 24.11; membrane metallo-endopeptidase variant 1; membrane metallo-endopeptidase variant 2; common acute lymphocytic leukemia antigen; membrane metallo-endopeptidase (neutral endopeptidase, enkephalinase); membrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10); SFE; MGC126681; MGC126707; DKFZp686O16152
• Gene ID: 4311
• mRNA Refseq: NM_000902
• Protein Refseq: NP_000893
• MIM: 120520
• UniProt ID: P08473
• Chromosome Location: 3q25.2
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Renin-angiotensin system, organism-specific biosystem
• Function: endopeptidase activity; endopeptidase activity; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; peptidase activity; peptide binding; protein binding; zinc ion binding