Recombinant Human MME
Cat.No. : | MME-26365TH |
Product Overview : | Recombinant fragment corresponding to amino acids 145-249 of Human CD10 with an N terminal proprietary tag; Predicted MWt 37.29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 105 amino acids |
Description : | This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5 untranslated region of this gene is alternatively spliced, resulting in four separate mRNA transcripts. The coding region is not affected by alternative splicing. |
Molecular Weight : | 37.290kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTA EKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRL GLPSRDYYECTGIYKEACTAYVDFM |
Sequence Similarities : | Belongs to the peptidase M13 family. |
Gene Name | MME membrane metallo-endopeptidase [ Homo sapiens ] |
Official Symbol | MME |
Synonyms | MME; membrane metallo-endopeptidase; neprilysin; CALLA; CD10; enkephalinase; NEP; neutral endopeptidase; |
Gene ID | 4311 |
mRNA Refseq | NM_000902 |
Protein Refseq | NP_000893 |
MIM | 120520 |
Uniprot ID | P08473 |
Chromosome Location | 3q21-q27 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; |
Function | metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptide binding; |
◆ Recombinant Proteins | ||
MME-5466H | Recombinant Human MME protein, His-tagged | +Inquiry |
MME-6249H | Recombinant Human MME Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MME-5409H | Recombinant Human MME Protein, GST-tagged | +Inquiry |
MME-196C | Recombinant Cynomolgus MME, His-tagged | +Inquiry |
MME-1230C | Recombinant Chicken MME | +Inquiry |
◆ Cell & Tissue Lysates | ||
MME-2688MCL | Recombinant Mouse MME cell lysate | +Inquiry |
MME-1800HCL | Recombinant Human MME cell lysate | +Inquiry |
MME-001CCL | Recombinant Cynomolgus MME cell lysate | +Inquiry |
MME-1083RCL | Recombinant Rat MME cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MME Products
Required fields are marked with *
My Review for All MME Products
Required fields are marked with *
0
Inquiry Basket