Recombinant Human MLLT10 Protein, GST-tagged

• Cat.No.: MLLT10-5391H
• Product Overview: Human MLLT10 partial ORF ( NP_001009569, 695 a.a. - 793 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transcription factor and has been identified as a partner gene involved in several chromosomal rearrangements resulting in various leukemias. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]
• Molecular Mass: 36.63 kDa
• AA Sequence: QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MLLT10 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10 [ Homo sapiens ]
• Official Symbol: MLLT10
• Synonyms: MLLT10; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10; myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 10; protein AF-10; AF10; type I AF10 protein; type IV AF10 protein; type III AF10 protein; ALL1-fused gene from chromosome 10 protein; MGC75086; DKFZp686E10210
• Gene ID: 8028
• mRNA Refseq: NM_001195626
• Protein Refseq: NP_001182555
• MIM: 602409
• UniProt ID: P55197