Recombinant Human MLF1 protein, GST-tagged
Cat.No. : | MLF1-2390H |
Product Overview : | Recombinant Human MLF1(1 a.a. - 268 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-268 a.a. |
Description : | This gene encodes an oncoprotein which is thought to play a role in the phenotypic determination of hemopoetic cells. Translocations between this gene and nucleophosmin have been associated with myelodysplastic syndrome and acute myeloid leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57 kDa |
AA Sequence : | MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTM DQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSG LEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHEN PGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MLF1 myeloid leukemia factor 1 [ Homo sapiens ] |
Official Symbol | MLF1 |
Synonyms | MLF1; myeloid leukemia factor 1; myeloid leukemia factor 1 variant 1; myeloid leukemia factor 1 variant 2; myeloid leukemia factor 1 variant 3; myelodysplasia-myeloid leukemia factor 1; |
Gene ID | 4291 |
mRNA Refseq | NM_001130156 |
Protein Refseq | NP_001123628 |
MIM | 601402 |
UniProt ID | P58340 |
Chromosome Location | 3q25 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; DNA binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
MLF1-643HF | Recombinant Full Length Human MLF1 Protein, GST-tagged | +Inquiry |
MLF1-2390H | Recombinant Human MLF1 protein, GST-tagged | +Inquiry |
MLF1-29154TH | Recombinant Human MLF1, T7 -tagged | +Inquiry |
MLF1-3438H | Recombinant Human MLF1 protein, His-tagged | +Inquiry |
MLF1-2780R | Recombinant Rhesus monkey MLF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLF1-4297HCL | Recombinant Human MLF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLF1 Products
Required fields are marked with *
My Review for All MLF1 Products
Required fields are marked with *
0
Inquiry Basket