Recombinant Human MKI67 protein(3120-3256aa), His-tagged

Cat.No. : MKI67-245H
Product Overview : Recombinant Human MKI67 protein(P46013)(3120-3256aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 3120-3256aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.3kDa
AA Sequence : NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ]
Official Symbol MKI67
Synonyms MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA
Gene ID 4288
mRNA Refseq NM_001145966
Protein Refseq NP_001139438
MIM 176741
UniProt ID P46013

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MKI67 Products

Required fields are marked with *

My Review for All MKI67 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon