Recombinant Human MKI67 protein, GST-tagged

• Cat.No.: MKI67-8543H
• Product Overview: Recombinant Human MKI67(3157 a.a. - 3256 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAE NPKKAEDNVCVKKIRTRSHRDSEDI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 3157-3256 a.a.

Gene Information

• Gene Name: MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ]
• Official Symbol: MKI67
• Synonyms: MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA
• Gene ID: 4288
• mRNA Refseq: NM_002417
• Protein Refseq: NP_002408
• MIM: 176741
• UniProt ID: P46013
• Chromosome Location: 10q26.2
• Function: ATP binding; nucleotide binding; protein C-terminus binding; protein binding