Recombinant Human MKI67 protein, GST-tagged

Cat.No. : MKI67-8543H
Product Overview : Recombinant Human MKI67(3157 a.a. - 3256 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 3157-3256 a.a.
Description : This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAE NPKKAEDNVCVKKIRTRSHRDSEDI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ]
Official Symbol MKI67
Synonyms MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA;
Gene ID 4288
mRNA Refseq NM_002417
Protein Refseq NP_002408
MIM 176741
UniProt ID P46013
Chromosome Location 10q26.2
Function ATP binding; nucleotide binding; protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MKI67 Products

Required fields are marked with *

My Review for All MKI67 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon