Recombinant Human MKI67 protein, GST-tagged
Cat.No. : | MKI67-8543H |
Product Overview : | Recombinant Human MKI67(3157 a.a. - 3256 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 3157-3256 a.a. |
Description : | This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAE NPKKAEDNVCVKKIRTRSHRDSEDI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ] |
Official Symbol | MKI67 |
Synonyms | MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA; |
Gene ID | 4288 |
mRNA Refseq | NM_002417 |
Protein Refseq | NP_002408 |
MIM | 176741 |
UniProt ID | P46013 |
Chromosome Location | 10q26.2 |
Function | ATP binding; nucleotide binding; protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
MKI67-4552H | Recombinant Human MKI67 Protein (Gly3088-Lys3235), N-His tagged | +Inquiry |
MKI67-8560H | Recombinant Human MKI67 protein, GST-tagged | +Inquiry |
MKI67-28648TH | Recombinant Human MKI67, His-tagged | +Inquiry |
MKI67-8543H | Recombinant Human MKI67 protein, GST-tagged | +Inquiry |
MKI67-1780R | Recombinant Rabbit MKI67 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MKI67 Products
Required fields are marked with *
My Review for All MKI67 Products
Required fields are marked with *
0
Inquiry Basket