Recombinant Human MIXL1 Protein, GST-tagged

• Cat.No.: MIXL1-5357H
• Product Overview: Human MIXL1 full-length ORF ( ADR83322.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Homeodomain proteins, such as MIXL1, are transcription factors that regulate cell fate during development (Hart et al., 2005 [PubMed 15982639]).[supplied by OMIM
• Molecular Mass: 25.6 kDa
• AA Sequence: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIXL1 Mix paired-like homeobox [ Homo sapiens ]
• Official Symbol: MIXL1
• Synonyms: MIXL1; Mix paired-like homeobox; Mix1 homeobox (Xenopus laevis) like 1 , Mix1 homeobox like 1 (Xenopus laevis); homeobox protein MIXL1; MILD1; MIXL; hMix; homeodomain protein MIX; Mix-like homeobox protein 1; mix.1 homeobox-like protein; MIX1 homeobox-like protein 1; MIX; MGC138179
• Gene ID: 83881
• mRNA Refseq: NM_031944
• Protein Refseq: NP_114150
• MIM: 609852
• UniProt ID: Q9H2W2