Recombinant Human MGAT1

• Cat.No.: MGAT1-29206TH
• Product Overview: Recombinant fragment of Human MGAT1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I is a medial-Golgi enzyme essential for the synthesis of hybrid and complex N-glycans. The protein, encoded by a single exon, shows typical features of a type II transmembrane protein. The protein is believed to be essential for normal embryogenesis. Several variants encoding the same protein have been found for this gene.
• Molecular Weight: 36.410kDa inclusive of tags
• Tissue specificity: Appears to be present in all tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSWN
• Sequence Similarities: Belongs to the glycosyltransferase 13 family.

Gene Information

• Gene Name: MGAT1 mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [ Homo sapiens ]
• Official Symbol: MGAT1
• Synonyms: MGAT1; mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase; GLYT1, MGAT; alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase; GLCNAC TI; GNT 1
• Gene ID: 4245
• mRNA Refseq: NM_001114617
• Protein Refseq: NP_001108089
• MIM: 160995
• Uniprot ID: P26572
• Chromosome Location: 5
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem
• Function: acetylglucosaminyltransferase activity; alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups