Recombinant Human MFAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MFAP5-3683H |
Product Overview : | MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 19.6 kDa |
AA Sequence : | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MFAP5 microfibrillar associated protein 5 [ Homo sapiens (human) ] |
Official Symbol | MFAP5 |
Synonyms | MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2; |
Gene ID | 8076 |
mRNA Refseq | NM_003480 |
Protein Refseq | NP_003471 |
MIM | 601103 |
UniProt ID | Q13361 |
◆ Recombinant Proteins | ||
MFAP5-3683H | Recombinant Human MFAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP5-5512M | Recombinant Mouse MFAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFAP5-290H | Recombinant Human MFAP5 Protein, His-tagged | +Inquiry |
Mfap5-292R | Recombinant Rat Mfap5 Protein, His-tagged | +Inquiry |
MFAP5-1927H | Recombinant Human MFAP5 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *
0
Inquiry Basket