Recombinant Human METTL6 Protein, GST-tagged

Cat.No. : METTL6-4400H
Product Overview : Human METTL6 full-length ORF ( AAH22400.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : METTL6 (Methyltransferase Like 6) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity. An important paralog of this gene is METTL2B.
Molecular Mass : 56.5 kDa
AA Sequence : MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL6 methyltransferase like 6 [ Homo sapiens ]
Official Symbol METTL6
Synonyms METTL6; methyltransferase like 6; methyltransferase-like protein 6; MGC24132;
Gene ID 131965
mRNA Refseq NM_152396
Protein Refseq NP_689609
UniProt ID Q8TCB7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All METTL6 Products

Required fields are marked with *

My Review for All METTL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon